LL-37 5mg

Our LL-37 5mg vial holds 5mg of lyophilized LL-37, a human cathelicidin antimicrobial peptide. It’s sold for laboratory research only.

What is LL-37?

LL-37 is the only cathelicidin antimicrobial peptide humans make. It’s 37 amino acids long and starts with two leucines, which is where the name comes from. It’s cut from a larger precursor protein, hCAP-18, and is found in white blood cells, skin and the lining of the airways and gut.

It’s amphipathic, with one charged face and one oily face, so it can sit in and disrupt bacterial membranes.

LL-37 mechanism of action

LL-37 has a positively charged face that’s drawn to the negatively charged membranes of bacteria. Once it’s there, its oily face pushes into the membrane and makes holes.

It does more than kill microbes. It binds bacterial endotoxin, recruits immune cells and stimulates new blood vessel growth, which ties it into wound healing studies.

LL-37 5mg product details

• Compound: LL-37
• Also known as: cathelicidin, CAP-18 fragment
• CAS number: 154947-66-7
• Molecular formula: C205H340N60O53
• Molar mass: 4,493.3 g/mol
• Structure: [LL-37, 37 aa]
• Amount: 5mg per vial
• Form: lyophilized (freeze-dried) powder
• Label: compound name and amount printed on every unit
• SKU: LL37-5
• Use: laboratory research only

LL-37 research

Lab work shows it kills a wide range of bacteria and some fungi and viruses in culture, and it also acts as a signaling molecule in inflammation and wound repair. Heilborn and colleagues reported in 2003 that it’s needed for normal re-epithelialization of human skin wounds in culture.

Human data are limited to small early-phase studies, for example on venous leg ulcers.

To read the papers yourself, start with this PubMed search for LL-37.

LL-37 5mg vs related compounds

Here’s how LL-37 5mg fits among related compounds. LL-37 is the only human cathelicidin, an antimicrobial peptide that also signals in wound repair. By comparison:

• Thymosin Alpha-1 is a 28-amino-acid thymic peptide, approved in several countries as thymalfasin
• Thymalin is a calf-thymus peptide complex from Khavinson’s program, registered in Russia as an immune medicine
• VIP is a 28-amino-acid neuropeptide that relaxes smooth muscle and calms immune cells

These are all studied in immune research, but at different points: the thymus peptides on T-cell maturation and signaling, LL-37 on direct antimicrobial action and VIP on calming inflammation. See them all on our immune peptides page.

LL-37 5mg quality and handling

Every LL-37 5mg vial carries a printed label with the compound name and amount, so you always know what you’re holding. If your lab needs batch paperwork for its records, contact Peptira support before you order and ask what’s available for the current batch.

Labs that check material in-house normally confirm identity with mass spectrometry, which checks the molecular weight, and measure purity with HPLC, which separates the main compound from anything else in the sample.

Write the order date and the vial details into your lab notes. If a result looks odd later, you can tie it back to the exact material you used.

How to reconstitute LL-37 5mg

Here’s the math for 5mg of powder:

• 1mL of bacteriostatic water gives 5mg/mL
• 2mL of bacteriostatic water gives 2.5mg/mL
• 3mL of bacteriostatic water gives 1.67mg/mL

Go with whichever number is easiest to work with in your protocol, and label the vial with the concentration and the date you mixed it.

Most labs use sterile bacteriostatic water. We stock bacteriostatic water in 3mL, 10mL and 30mL sizes. Warm the sealed vial to room temperature, add the water slowly along the glass wall and swirl gently until it’s clear. Never shake it.

Storing LL-37 5mg

The dry powder keeps best cold and dark. A freezer at -20°C is right for long-term storage. After reconstitution, store it in the fridge at 2 to 8°C and finish it within roughly four weeks.

Leave sealed vials sealed until you need them. Dry powder in a closed vial lasts far longer than solution, so there’s no reason to mix more than one at a time.

Ordering LL-37 5mg for a full study

Work out the total amount before you order. Add up what each arm of the study uses across every time point, then divide by 5mg. Round up by one vial so a spoiled sample or a repeat run doesn’t stall the project.

Mix one vial at a time and keep the rest sealed in the freezer. Dry powder keeps far longer than solution, so there’s no reason to reconstitute everything at the start.

If you order more than one vial, check that the batch numbers match before you start. Running a whole study on one batch removes one variable.

Related to LL-37 5mg

• Vilon 20mg, a dipeptide bioregulator
• Thymalin 10mg, a thymic polypeptide complex
• KPV 10mg, an alpha-MSH tripeptide
• Thymosin Alpha-1 5mg, a thymic peptide
• Thymagen 20mg, a dipeptide bioregulator

Browse the full immune peptides and healing and recovery peptides range, see every vial on our research peptides page or head back to the Peptira home page.

Common questions about LL-37 5mg

How much is in the LL-37 5mg vial?

5mg of freeze-dried powder. The amount is printed on the label.

Can LL-37 be used in people or animals?

No. It’s sold for laboratory research only and isn’t approved for human or veterinary use.

Is LL-37 5mg in stock?

Yes. LL-37 5mg is in stock and ready to ship.

Where can I buy LL-37 5mg?

Right here at Peptira. Add LL-37 5mg to the cart on this page and it ships free worldwide.

What do I mix LL-37 5mg with?

Sterile bacteriostatic water is the usual choice. The reconstitution section above shows the concentration for each volume.

Buy LL-37 5mg online

This vial is in stock at $39.00. Add it to the cart, enter code PEPTIRA10 at checkout for 10% off, and shipping is free worldwide. Paying with crypto at checkout takes a little more off.

Need more for the same project? See the rest of our immune peptides and healing and recovery peptides, or go back to the Peptira home page.

For laboratory research use only. Not for human or veterinary use. These statements have not been evaluated by the FDA.